PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10035029
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 94aa    MW: 10450.5 Da    PI: 10.479
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10035029genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.84.4e-261059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  i +ks rqvtfskRr+g++KKA  +SvLCd++ a++ifs+ g+lye+ss
  Lus10035029 10 LIGDKSSRQVTFSKRRKGLFKKAADISVLCDVQLALVIFSPAGRLYEFSS 59
                 6889********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.81161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-26163IPR002100Transcription factor, MADS-box
SMARTSM004323.5E-33160IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-24323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-241157IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-243859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MGRRKVELKL IGDKSSRQVT FSKRRKGLFK KAADISVLCD VQLALVIFSP AGRLYEFSSG  60
DRLIHLIPPP HSFCLIIFSM TAQLLVLMIT DSE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-18161161Myocyte-specific enhancer factor 2B
1tqe_R1e-18161161Myocyte-specific enhancer factor 2B
1tqe_Q1e-18161161Myocyte-specific enhancer factor 2B
1tqe_P1e-18161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007043954.11e-26Flowering locus C, putative isoform 1
SwissprotQ9S7Q75e-24FLC_ARATH; MADS-box protein FLOWERING LOCUS C
TrEMBLQ6UGQ61e-26Q6UGQ6_PETHY; MADS-box protein 15
STRINGPOPTR_0003s16840.17e-24(Populus trichocarpa)
STRINGPOPTR_0003s16870.17e-24(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10140.22e-25MIKC_MADS family protein